PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC005308.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family TALE
Protein Properties Length: 570aa    MW: 61982.7 Da    PI: 6.3705
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC005308.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-093153521954
                   HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
      Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                   Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  EcC005308.20 315 FEHflHPYPKDSDKIMLARQTGLTRSQVSNWFINARVR 352
                   665559******************************88 PP

2BELL122.71.5e-39180251172
          BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                   e+q+lq+k +kLls+l+eVdkrYkqy++q+q+v+ sF+++ag g+akpYt+lAl++iSrhFrcL dai++qi
  EcC005308.20 180 EKQDLQNKLTKLLSMLDEVDKRYKQYYHQMQIVVQSFDTIAGSGAAKPYTALALQRISRHFRCLHDAITGQI 251
                   6899*******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.6E-58104249IPR006563POX domain
PfamPF075262.8E-50109248IPR006563POX domain
PROSITE profilePS5007112.212293356IPR001356Homeobox domain
SMARTSM003891.0E-9296360IPR001356Homeobox domain
CDDcd000863.14E-13296357No hitNo description
SuperFamilySSF466892.14E-17297363IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-29299362IPR009057Homeodomain-like
PfamPF059203.7E-18313352IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0030422Biological Processproduction of siRNA involved in RNA interference
GO:0032776Biological ProcessDNA methylation on cytosine
GO:0035563Biological Processpositive regulation of chromatin binding
GO:0050832Biological Processdefense response to fungus
GO:0060964Biological Processregulation of gene silencing by miRNA
GO:0070829Biological Processheterochromatin maintenance
GO:0071360Biological Processcellular response to exogenous dsRNA
GO:0080188Biological ProcessRNA-directed DNA methylation
GO:1900111Biological Processpositive regulation of histone H3-K9 dimethylation
GO:1900370Biological Processpositive regulation of RNA interference
GO:0000419Cellular ComponentDNA-directed RNA polymerase V complex
GO:0031618Cellular Componentnuclear pericentric heterochromatin
GO:0090577Cellular ComponentRNA polymerase IV transcription factor complex
GO:0003677Molecular FunctionDNA binding
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
SRSGDQDFSL WRDGRNEMLL MPPLQSPHGQ GLSLSLGTQI PSGIHMPSAN LSSISFLGPI  60
PMVSGDGGGR TGSERSRNAD CAPAGFPGGD EDVNKGGDIP YGMSTIVRVI PNSRYLRVAQ  120
QLLDEIVNVR KALKRPDDTN DQSRHENQRS PKDADGGSKN EASSNPQESA SNSSELSAAE  180
KQDLQNKLTK LLSMLDEVDK RYKQYYHQMQ IVVQSFDTIA GSGAAKPYTA LALQRISRHF  240
RCLHDAITGQ IQATRKSLGE QDTSNSNGIS RLRYVDQHLR QQRSMQHLGI MQQHAWRPQR  300
GLPENSVSIL RAWLFEHFLH PYPKDSDKIM LARQTGLTRS QVSNWFINAR VRLWKPMVEE  360
MYKEEIGDPE MDSNSSSETA AKATGGDGRS SEDKGEDLQQ SASSTATKRC GTGNFMDLKP  420
PVVNPEMEIS GPTFNSGTHG EVDAEYGFKL RGGHIPGGND GILFSDSIVQ SDGGNNRFMA  480
AATAAYNVSN FGQFGGGTGV SLTLGLQHCD GGTLPLSNSM DHGIASMRGD GFYNAAASSV  540
GAETMEFEGS SPGEQQHRLA SNQLFHDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A6e-17302359158Homeobox protein Meis1
4xrs_B6e-17302359158Homeobox protein Meis1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010066189.10.0PREDICTED: BEL1-like homeodomain protein 6
RefseqXP_010066190.10.0PREDICTED: BEL1-like homeodomain protein 6
TrEMBLA0A059BEC80.0A0A059BEC8_EUCGR; Uncharacterized protein
STRINGVIT_03s0038g00050.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-129BEL1-like homeodomain 6